GEM anticorps (N-Term)

N° du produit ABIN634547

Détail du produit anti-GEM anticorps

Antigène: GEM (GTP Binding Protein Overexpressed in Skeletal Muscle (GEM))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GEM est non-conjugé

Application: Western Blotting (WB)

Specificité: GEM antibody was raised against the N terminal of GEM

Purification: Affinity purified

Immunogène: GEM antibody was raised using the N terminal of GEM corresponding to a region with amino acids KEPHQYSHRNRHSATPEDHCRRSWSSDSTDSVISSESGNTYYRVVLIGEQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GEM Blocking Peptide, catalog no. 33R-4348, is also available for use as a blocking control in assays to test for specificity of this GEM antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GEM antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GEM

Antigène: GEM (GTP Binding Protein Overexpressed in Skeletal Muscle (GEM))

Autre désignation: GEM (GEM Produits)

Synonymes: anticorps KIR, anticorps GEM, anticorps DKFZp470D0612, anticorps LOC100221129, anticorps kir, anticorps xgem, anticorps zgc:153003, anticorps Gem, anticorps AV020497, anticorps GTP binding protein overexpressed in skeletal muscle, anticorps geminin, DNA replication inhibitor, anticorps GTP binding protein (gene overexpressed in skeletal muscle), anticorps GEM, anticorps gem, anticorps Gem, anticorps GMNN

Sujet: GEM belongs to the RAD/GEM family of GTP-binding proteins. It is associated with the inner face of the plasma membrane and could play a role as a regulatory protein in receptor-mediated signal transduction.

Poids moléculaire: 34 kDa (MW of target protein)