GEM anticorps (C-Term)
-
- Antigène Voir toutes GEM Anticorps
- GEM (GTP Binding Protein Overexpressed in Skeletal Muscle (GEM))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GEM est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- GEM antibody was raised against the C terminal of GEM
- Purification
- Purified
- Immunogène
- GEM antibody was raised using the C terminal of GEM corresponding to a region with amino acids FSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKL
- Top Product
- Discover our top product GEM Anticorps primaire
-
-
- Indications d'application
-
WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GEM Blocking Peptide, catalog no. 33R-3073, is also available for use as a blocking control in assays to test for specificity of this GEM antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GEM antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GEM (GTP Binding Protein Overexpressed in Skeletal Muscle (GEM))
- Autre désignation
- GEM (GEM Produits)
- Synonymes
- anticorps KIR, anticorps GEM, anticorps DKFZp470D0612, anticorps LOC100221129, anticorps kir, anticorps xgem, anticorps zgc:153003, anticorps Gem, anticorps AV020497, anticorps GTP binding protein overexpressed in skeletal muscle, anticorps geminin, DNA replication inhibitor, anticorps GTP binding protein (gene overexpressed in skeletal muscle), anticorps GEM, anticorps gem, anticorps Gem, anticorps GMNN
- Sujet
- GEM belongs to the RAD/GEM family of GTP-binding proteins. It is associated with the inner face of the plasma membrane and could play a role as a regulatory protein in receptor-mediated signal transduction.
- Poids moléculaire
- 33 kDa (MW of target protein)
-