G3BP1 anticorps (N-Term)

N° du produit ABIN630227

L’anticorps Lapin Polyclonal anti-G3BP1 a été validé pour WB. Il convient pour détecter G3BP1 dans des échantillons de Humain, Souris et Chien.

Aperçu rapide pour G3BP1 anticorps (N-Term) (ABIN630227)

Antigène: G3BP1 (GTPase Activating Protein (SH3 Domain) Binding Protein 1 (G3BP1))

Reactivité: Humain, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp G3BP1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-G3BP1 anticorps

Épitope: N-Term

Specificité: G3 BP antibody was raised against the N terminal Of G3 p

Purification: Purified

Immunogène: G3 BP antibody was raised using the N terminal Of G3 p corresponding to a region with amino acids EVFGGFVTEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQAVVSNDMEE

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

G3BP Blocking Peptide, (ABIN938171), is also available for use as a blocking control in assays to test for specificity of this G3BP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of G0 P antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur G3BP1

Antigène: G3BP1 (GTPase Activating Protein (SH3 Domain) Binding Protein 1 (G3BP1))

Autre désignation: G3BP

Sujet: G3BP is one of the DNA-unwinding enzymes which prefers partially unwound 3'-tailed substrates and can also unwind partial RNA/DNA and RNA/RNA duplexes in an ATP-dependent fashion. This enzyme is a member of the heterogeneous nuclear RNA-binding proteins and is also an element of the Ras signal transduction pathway. It binds specifically to the Ras-GTPase-activating protein by associating with its SH3 domain. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.

Poids moléculaire: 51 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome