G3BP1 anticorps (N-Term)

N° du produit ABIN630227

Détail du produit anti-G3BP1 anticorps

Antigène: G3BP1 (GTPase Activating Protein (SH3 Domain) Binding Protein 1 (G3BP1))

Épitope: N-Term

Reactivité: Humain, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp G3BP1 est non-conjugé

Application: Western Blotting (WB)

Specificité: G3 BP antibody was raised against the N terminal Of G3 p

Purification: Purified

Immunogène: G3 BP antibody was raised using the N terminal Of G3 p corresponding to a region with amino acids EVFGGFVTEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQAVVSNDMEE

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

G3BP Blocking Peptide, catalog no. 33R-2785, is also available for use as a blocking control in assays to test for specificity of this G3BP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of G0 P antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur G3BP1

Antigène: G3BP1 (GTPase Activating Protein (SH3 Domain) Binding Protein 1 (G3BP1))

Autre désignation: G3BP (G3BP1 Produits)

Synonymes: anticorps G3BP, anticorps HDH-VIII, anticorps fj17h05, anticorps zgc:56034, anticorps wu:fj17h05, anticorps g3bp, anticorps MGC53271, anticorps G3BP1, anticorps G3bp, anticorps RGD1310666, anticorps AI849976, anticorps B430204O07, anticorps C87777, anticorps mKIAA4115, anticorps G3BP stress granule assembly factor 1, anticorps GTPase activating protein (SH3 domain) binding protein 1, anticorps GTPase activating protein (SH3 domain) binding protein 1 L homeolog, anticorps Ras-GTPase-activating protein SH3-domain-binding protein, anticorps G3BP1, anticorps g3bp1, anticorps g3bp1.L, anticorps LOC100304885, anticorps G3bp1

Sujet: G3BP is one of the DNA-unwinding enzymes which prefers partially unwound 3'-tailed substrates and can also unwind partial RNA/DNA and RNA/RNA duplexes in an ATP-dependent fashion. This enzyme is a member of the heterogeneous nuclear RNA-binding proteins and is also an element of the Ras signal transduction pathway. It binds specifically to the Ras-GTPase-activating protein by associating with its SH3 domain. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.

Poids moléculaire: 51 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome