Annexin VII anticorps (N-Term)

N° du produit ABIN630240

Détail du produit anti-Annexin VII anticorps

Antigène: Annexin VII (ANXA7) (Annexin A7 (ANXA7))

Épitope: N-Term

Reactivité: Chemical

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Annexin VII est non-conjugé

Application: Western Blotting (WB)

Specificité: Annexin A7 antibody was raised against the N terminal of ANXA7

Réactivité croisée: Humain

Purification: Purified

Immunogène: Annexin A7 antibody was raised using the N terminal of ANXA7 corresponding to a region with amino acids MSYPGYPPTGYPPFPGYPPAGQESSFPPSGQYPYPSGFPPMGGGAYPQVP

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Annexin A7 Blocking Peptide, catalog no. 33R-6528, is also available for use as a blocking control in assays to test for specificity of this Annexin A7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Annexin VII

Antigène: Annexin VII (ANXA7) (Annexin A7 (ANXA7))

Autre désignation: Annexin A7 (ANXA7 Produits)

Synonymes: anticorps ANX7, anticorps SNX, anticorps SYNEXIN, anticorps AI265384, anticorps AI316497, anticorps Anx7, anticorps synexin, anticorps anxa7, anticorps MGC76267, anticorps MGC82023, anticorps ANXA7, anticorps MGC83033, anticorps annexin A7, anticorps annexin VII, anticorps annexin A7 S homeolog, anticorps ANXA7, anticorps Anxa7, anticorps anxa7, anticorps anxa7.S, anticorps PTRG_02166, anticorps BRAFLDRAFT_231082, anticorps PAAG_00136, anticorps MCYG_04180, anticorps VDBG_06328, anticorps MGYG_02426

Classe de substances: Chemical

Sujet: ANXA7 is a member of the annexin family of calcium-dependent phospholipid binding proteins. The Annexin VII gene contains 14 exons and spans approximately 34 kb of DNA. An alternatively spliced cassette exon results in two mRNA transcripts of 2.0 and 2.4 kb which are predicted to generate two protein isoforms differing in their N-terminal domain. The alternative splicing event is tissue specific and the mRNA containing the cassette exon is prevalent in brain, heart and skeletal muscle.

Poids moléculaire: 51 kDa (MW of target protein)