Annexin V anticorps (N-Term)

N° du produit ABIN630241

Détail du produit anti-Annexin V anticorps

Antigène: Annexin V (ANXA5) (Annexin A5 (ANXA5))

Épitope: N-Term

Reactivité: Chemical

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Annexin V est non-conjugé

Application: Western Blotting (WB)

Specificité: Annexin A5 antibody was raised against the N terminal of ANXA5

Réactivité croisée: Humain, Souris, Rat (Rattus), Chien

Purification: Purified

Immunogène: Annexin A5 antibody was raised using the N terminal of ANXA5 corresponding to a region with amino acids SELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPE

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Annexin A5 Blocking Peptide, catalog no. 33R-8393, is also available for use as a blocking control in assays to test for specificity of this Annexin A5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Annexin V

Antigène: Annexin V (ANXA5) (Annexin A5 (ANXA5))

Autre désignation: Annexin A5 (ANXA5 Produits)

Synonymes: anticorps anx, anticorps anx5, anticorps ANX V, anticorps anxa5, anticorps cb989, anticorps wu:fa98f06, anticorps wu:fj10f10, anticorps MGC89158, anticorps ANX5, anticorps ENX2, anticorps PP4, anticorps RPRGL3, anticorps Anx5, anticorps R74653, anticorps LC5, anticorps enx2, anticorps annexin A5, anticorps annexin A5b, anticorps Annexin A5, anticorps annexin A5 L homeolog, anticorps ANXA5, anticorps anxa5b, anticorps anxa5, anticorps Anxa5, anticorps anxa5.L

Classe de substances: Chemical

Sujet: The protein encoded by ANXA5 belongs to the annexin family of calcium-dependent phospholipid binding proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII.

Poids moléculaire: 35 kDa (MW of target protein)

Pathways: Apoptose