Annexin A13 anticorps (N-Term)

N° du produit ABIN630247

Détail du produit anti-Annexin A13 anticorps

Antigène: Annexin A13 (ANXA13)

Épitope: N-Term

Reactivité: Chemical

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Annexin A13 est non-conjugé

Application: Western Blotting (WB)

Specificité: Annexin A13 antibody was raised against the N terminal of ANXA13

Réactivité croisée: Humain, Chien

Purification: Purified

Immunogène: Annexin A13 antibody was raised using the N terminal of ANXA13 corresponding to a region with amino acids KKLNKACKGMGTNEAAIIEILSGRTSDERQQIKQKYKATYGKELEEVLKS

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Annexin A13 Blocking Peptide, catalog no. 33R-4483, is also available for use as a blocking control in assays to test for specificity of this Annexin A13 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Annexin A13

Antigène: Annexin A13 (ANXA13)

Autre désignation: Annexin A13 (ANXA13 Produits)

Synonymes: anticorps ANX13, anticorps ISA, anticorps anxa6, anticorps MGC82170, anticorps 1810034H17Rik, anticorps AV055219, anticorps anx13, anticorps wu:fb40a08, anticorps ANXA13, anticorps MGC108373, anticorps annexin A13, anticorps annexin A13 L homeolog, anticorps ANXA13, anticorps anxa13.L, anticorps Anxa13, anticorps anxa13, anticorps PAAG_01138

Classe de substances: Chemical

Sujet: The ANXA13 gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. The specific function of ANXA13 has not yet been determined, however, it is associated with the plasma membrane of undifferentiated, proliferating endothelial cells and differentiated villus enterocytes.

Poids moléculaire: 39 kDa (MW of target protein)