Annexin IV anticorps (N-Term)

N° du produit ABIN630249

Détail du produit anti-Annexin IV anticorps

Antigène: Annexin IV (ANXA4) (Annexin A4 (ANXA4))

Épitope: N-Term

Reactivité: Chemical

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Annexin IV est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: Annexin A4 antibody was raised against the N terminal of ANXA4

Réactivité croisée: Humain, Rat (Rattus), Chien

Purification: Purified

Immunogène: Annexin A4 antibody was raised using the N terminal of ANXA4 corresponding to a region with amino acids GLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQ

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Annexin A4 Blocking Peptide, catalog no. 33R-3396, is also available for use as a blocking control in assays to test for specificity of this Annexin A4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Annexin IV

Antigène: Annexin IV (ANXA4) (Annexin A4 (ANXA4))

Autre désignation: Annexin A4 (ANXA4 Produits)

Synonymes: anticorps ANXA4, anticorps Anx4, anticorps XAnx4, anticorps pig28, anticorps X-anx4, anticorps Xanx-4, anticorps ANXIV, anticorps anx4, anticorps ANX4, anticorps PIG28, anticorps ZAP36, anticorps Annexin-4, anticorps P32.5, anticorps PAP-II, anticorps PP4-X, anticorps AI265406, anticorps AIV, anticorps AW106930, anticorps annexin A4, anticorps annexin A4 L homeolog, anticorps ANXA4, anticorps anxa4, anticorps CC1G_00713, anticorps LOC100280951, anticorps Anxa4, anticorps anxa4.L

Classe de substances: Chemical

Sujet: Annexin A4 (ANXA4) belongs to the annexin family of calcium-dependent phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. ANXA4 has 45 to 59 % identity with other members of its family and shares a similar size and exon-intron organization. Isolated from human placenta, ANXA4 encodes a protein that has possible interactions with ATP, and has in vitro anticoagulant activity and also inhibits phospholipase A2 activity. ANXA4 is almost exclusively expressed in epithelial cells.

Poids moléculaire: 35 kDa (MW of target protein)