Annexin A2 anticorps (C-Term)

N° du produit ABIN630252

Cet anticorps anti-Annexin A2 est un anticorps Lapin Polyclonal détectant Annexin A2 dans WB. Adapté pour Chemical.

Aperçu rapide pour Annexin A2 anticorps (C-Term) (ABIN630252)

Antigène: Annexin A2 (ANXA2)

Reactivité: Chemical

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Annexin A2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Annexin A2 anticorps

Épitope: C-Term

Specificité: Annexin A2 antibody was raised against the C terminal of ANXA2

Réactivité croisée: Humain, Souris, Chien

Purification: Purified

Immunogène: Annexin A2 antibody was raised using the C terminal of ANXA2 corresponding to a region with amino acids RIMVSRSEVDMLKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Annexin A2 Blocking Peptide, (ABIN5612078), is also available for use as a blocking control in assays to test for specificity of this Annexin A2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Annexin A2

Antigène: Annexin A2 (ANXA2)

Autre désignation: Annexin A2

Classe de substances: Chemical

Sujet: ANXA2 encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. This protein functions as an autocrine factor which heightens osteoclast formation and bone resorption. ANXA2 has three pseudogenes located on chromosomes 4, 9 and 10, respectively. Multiple alternatively spliced transcript variants encoding different isoforms have been found for ANXA2.

Poids moléculaire: 37 kDa (MW of target protein)

Pathways: S100 Proteins