Annexin a1 anticorps (N-Term)

N° du produit ABIN630276

Détail du produit anti-Annexin a1 anticorps

Antigène: Annexin a1 (ANXA1) (Annexin A1 (ANXA1))

Épitope: N-Term

Reactivité: Chemical

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Annexin a1 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: Annexin A1 antibody was raised against the N terminal of ANXA1

Réactivité croisée: Humain

Purification: Purified

Immunogène: Annexin A1 antibody was raised using the N terminal of ANXA1 corresponding to a region with amino acids WFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGVD

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Annexin A1 Blocking Peptide, catalog no. 33R-9944, is also available for use as a blocking control in assays to test for specificity of this Annexin A1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANXA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Annexin a1

Antigène: Annexin a1 (ANXA1) (Annexin A1 (ANXA1))

Autre désignation: Annexin A1 (ANXA1 Produits)

Synonymes: anticorps anx1a, anticorps anxa1, anticorps wu:fa01d11, anticorps wu:fa05d11, anticorps wu:fk69h01, anticorps MGC64363, anticorps anx1, anticorps lpc1, anticorps MGC89164, anticorps ANXA1, anticorps ANX1, anticorps LPC1, anticorps p35, anticorps Anx-1, anticorps Anx-A1, anticorps C430014K04Rik, anticorps Lpc-1, anticorps Lpc1, anticorps Anx1, anticorps annexin A1a, anticorps annexin A1, anticorps annexin A1 L homeolog, anticorps Annexin A1, anticorps anxa1a, anticorps anxa1, anticorps anxa1.L, anticorps ANXA1, anticorps LOC100335033, anticorps Anxa1

Classe de substances: Chemical

Sujet: ANXA1 encodes a protein that belongs to a family of Ca(2+)-dependent phospholipid binding proteins which have a molecular weight of approximately 35,000 to 40,000 and are preferentially located on the cytosolic face of the plasma membrane. Annexin I protein has an apparent relative molecular mass of 40 kDa, with phospholipase A2 inhibitory activity. Since phospholipase A2 is required for the biosynthesis of the potent mediators of inflammation, prostaglandins and leukotrienes, annexin I may have potential anti-inflammatory activity.

Poids moléculaire: 38 kDa (MW of target protein)

Pathways: Hormone Transport