DKK1 anticorps

N° du produit ABIN630289

Cet anticorps Lapin Polyclonal détecte spécifiquement DKK1 dans WB. Il présente une réactivité avec des échantillons de Humain, Rat et Chien.

Aperçu rapide pour DKK1 anticorps (ABIN630289)

Antigène: DKK1 (Dickkopf Homolog 1 (DKK1))

Reactivité: Humain, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DKK1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DKK1 anticorps

Purification: Purified

Immunogène: DKK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CARHFWSKICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKD

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DKK1 Blocking Peptide, (ABIN937031), is also available for use as a blocking control in assays to test for specificity of this DKK1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DKK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DKK1

Antigène: DKK1 (Dickkopf Homolog 1 (DKK1))

Autre désignation: DKK1

Sujet: DKK1 is a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma.

Poids moléculaire: 26 kDa (MW of target protein)

Pathways: Signalisation WNT, Regulation of Muscle Cell Differentiation, Positive Regulation of fat Cell Differentiation