ZFYVE27 anticorps (Middle Region)

N° du produit ABIN630302

L’anticorps Lapin Polyclonal anti-ZFYVE27 a été validé pour WB. Il convient pour détecter ZFYVE27 dans des échantillons de Humain, Rat, Souris et Chien.

Aperçu rapide pour ZFYVE27 anticorps (Middle Region) (ABIN630302)

Antigène: ZFYVE27 (Zinc Finger, FYVE Domain Containing 27 (ZFYVE27))

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ZFYVE27 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ZFYVE27 anticorps

Épitope: Middle Region

Specificité: ZFYVE27 antibody was raised against the middle region of ZFYVE27

Purification: Purified

Immunogène: ZFYVE27 antibody was raised using the middle region of ZFYVE27 corresponding to a region with amino acids VGGKDGLMDSTPALTPTESLSSQDLTPGSVEEAEEAEPDEEFKDAIEETH

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ZFYVE27 Blocking Peptide, (ABIN5617113), is also available for use as a blocking control in assays to test for specificity of this ZFYVE27 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZFYVE27 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ZFYVE27

Antigène: ZFYVE27 (Zinc Finger, FYVE Domain Containing 27 (ZFYVE27))

Autre désignation: ZFYVE27

Sujet: ZFYVE27 may be associated with the neuronal intracellular trafficking in the corticospinal tract, which is consistent with the pathology of HSP.

Poids moléculaire: 46 kDa (MW of target protein)

Pathways: Neurotrophin Signaling Pathway