COX IV anticorps (N-Term)

N° du produit ABIN630318

Cet anticorps anti-COX IV est un anticorps Lapin Polyclonal détectant COX IV dans WB et IHC. Adapté pour Humain.

Aperçu rapide pour COX IV anticorps (N-Term) (ABIN630318)

Antigène: COX IV (COX4I1) (Cytochrome C Oxidase Subunit IV Isoform 1 (COX4I1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp COX IV est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-COX IV anticorps

Épitope: N-Term

Specificité: COX4 I1 antibody was raised against the N terminal of COX4 1

Purification: Purified

Immunogène: COX4 I1 antibody was raised using the N terminal of COX4 1 corresponding to a region with amino acids AISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALK

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 2 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

COX4I1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this COX4I1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COX0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur COX IV

Antigène: COX IV (COX4I1) (Cytochrome C Oxidase Subunit IV Isoform 1 (COX4I1))

Autre désignation: COX4I1

Sujet: Cytochrome c oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. COX4I1 is the nuclear-encoded subunit IV isoform 1 of the human mitochondrial respiratory chain enzyme.

Poids moléculaire: 19 kDa (MW of target protein)

Pathways: Proton Transport