SLC25A46 anticorps (N-Term)

N° du produit ABIN630320

L’anticorps Lapin Polyclonal anti-SLC25A46 a été validé pour WB. Il convient pour détecter SLC25A46 dans des échantillons de Humain, Souris, Rat et Poisson zèbre (Danio rerio).

Aperçu rapide pour SLC25A46 anticorps (N-Term) (ABIN630320)

Antigène: SLC25A46 (Solute Carrier Family 25, Member 46 (SLC25A46))

Reactivité: Humain, Souris, Rat, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC25A46 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SLC25A46 anticorps

Épitope: N-Term

Specificité: SLC25 A46 antibody was raised against the N terminal of SLC25 46

Purification: Purified

Immunogène: SLC25 A46 antibody was raised using the N terminal of SLC25 46 corresponding to a region with amino acids RSFSTGSDLGHWVTTPPDIPGSRNLHWGEKSPPYGVPTTSTPYEGPTEEP

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC25A46 Blocking Peptide, (ABIN5616228), is also available for use as a blocking control in assays to test for specificity of this SLC25A46 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 46 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC25A46

Antigène: SLC25A46 (Solute Carrier Family 25, Member 46 (SLC25A46))

Autre désignation: SLC25A46

Sujet: SLC25A46 is a members of the solute carrier family 25 (SLC25) which is known to transport molecules over the mitochondrial membrane.

Poids moléculaire: 46 kDa (MW of target protein)