Fukutin anticorps (N-Term)
-
- Antigène Voir toutes Fukutin (FKTN) Anticorps
- Fukutin (FKTN)
-
Épitope
- N-Term
-
Reactivité
- Humain, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp Fukutin est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- FKTN antibody was raised against the N terminal Of Fktn
- Purification
- Purified
- Immunogène
- FKTN antibody was raised using the N terminal Of Fktn corresponding to a region with amino acids TAFALQYHLWKNEEGWFRIAENMGFQCLKIESKDPRLDGIDSLSGTEIPL
- Top Product
- Discover our top product FKTN Anticorps primaire
-
anti-Fukutin (FKTN) (AA 272-456) antibody
FKTN Reactivité: Humain WB, IHC, IHC (p), IF, ICC Hôte: Lapin Polyclonal unconjugated
anti-Fukutin (FKTN) (AA 177-206) antibodyFKTN Reactivité: Humain WB, IHC (p) Hôte: Lapin Polyclonal RB31283 unconjugated
anti-Fukutin (FKTN) (AA 29-138) antibodyFKTN Reactivité: Humain WB, ELISA Hôte: Souris Polyclonal unconjugated
anti-Fukutin (FKTN) antibodyFKTN Reactivité: Humain WB, IHC (p), IF, ICC Hôte: Lapin Polyclonal unconjugated
anti-Fukutin (FKTN) (AA 111-160) antibodyFKTN Reactivité: Humain, Rat, Chien, Cheval, Lapin, Porc, Roussette (Chauve-souris), Singe WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
anti-Fukutin (FKTN) antibodyFKTN Reactivité: Humain WB, IHC Hôte: Lapin Monoclonal unconjugated
anti-Fukutin (FKTN) (AA 87-276) antibodyFKTN Reactivité: Humain WB, ELISA Hôte: Lapin Polyclonal unconjugated
anti-Fukutin (FKTN) antibodyFKTN Reactivité: Humain, Souris WB, ELISA Hôte: Lapin Polyclonal unconjugated
anti-Fukutin (FKTN) (N-Term) antibodyFKTN Reactivité: Humain, Souris, Rat, Chien, Cheval, Lapin, Cobaye, Boeuf (Vache), Porc WB, IHC Hôte: Lapin Polyclonal unconjugated
anti-Fukutin (FKTN) (AA 184-214), (Middle Region) antibodyFKTN Reactivité: Humain, Souris WB, IHC (p), EIA Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FKTN Blocking Peptide, catalog no. 33R-8971, is also available for use as a blocking control in assays to test for specificity of this FKTN antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FKTN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- Fukutin (FKTN)
- Autre désignation
- FKTN (FKTN Produits)
- Synonymes
- anticorps FCMD, anticorps fcmd, anticorps im:7163166, anticorps zgc:162828, anticorps FKTN, anticorps CMD1X, anticorps LGMD2M, anticorps MDDGA4, anticorps MDDGB4, anticorps MDDGC4, anticorps D830030O17Rik, anticorps Fcmd, anticorps fukutin, anticorps fukutin S homeolog, anticorps Fukutin, anticorps FKTN, anticorps fktn, anticorps fktn.S, anticorps Bm1_09375, anticorps Bm1_09380, anticorps Bm1_44655, anticorps Fktn
- Sujet
- FKTN regulates the migration and assembly of neurons during cortical histogenesis. Fukuyama congenital muscular dystrophy results from mutations in its gene.
- Poids moléculaire
- 51 kDa (MW of target protein)
- Pathways
- Regulation of Carbohydrate Metabolic Process
-
