SEC63 anticorps

N° du produit ABIN630338

L’anticorps Lapin Polyclonal anti-SEC63 a été validé pour WB. Il convient pour détecter SEC63 dans des échantillons de Humain, Souris et Chien.

Aperçu rapide pour SEC63 anticorps (ABIN630338)

Antigène: SEC63 (SEC63 Homolog (SEC63))

Reactivité: Humain, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SEC63 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-SEC63 anticorps

Purification: Purified

Immunogène: SEC63 antibody was raised using a synthetic peptide corresponding to a region with amino acids WWLYIADRKEQTLISMPYHVCTLKDTEEVELKFPAPGKPGNYQYTVFLRS

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SEC63 Blocking Peptide, (ABIN935994), is also available for use as a blocking control in assays to test for specificity of this SEC63 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEC63 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SEC63

Antigène: SEC63 (SEC63 Homolog (SEC63))

Autre désignation: SEC63

Sujet: The Sec61 complex is the central component of the protein translocation apparatus of the endoplasmic reticulum (ER) membrane. SEC63 and SEC62 protein are found to be associated with ribosome-free SEC61 complex. It is speculated that Sec61-Sec62-Sec63 may perform post-translational protein translocation into the ER. The Sec61-Sec62-Sec63 complex might also perform the backward transport of ER proteins that are subject to the ubiquitin-proteasome-dependent degradation pathway. SEC63 is an integral membrane protein located in the rough ER.

Poids moléculaire: 88 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling