TRIM59 anticorps (Middle Region)

N° du produit ABIN630352

Cet anticorps Lapin Polyclonal détecte spécifiquement TRIM59 dans WB et IHC. Il présente une réactivité envers Humain, Souris, Rat et Chien.

Aperçu rapide pour TRIM59 anticorps (Middle Region) (ABIN630352)

Antigène: TRIM59 (Tripartite Motif Containing 59 (TRIM59))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRIM59 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-TRIM59 anticorps

Épitope: Middle Region

Specificité: TRIM59 antibody was raised against the middle region of TRIM59

Purification: Purified

Immunogène: TRIM59 antibody was raised using the middle region of TRIM59 corresponding to a region with amino acids LEKVDDVRQHVQILKQRPLPEVQPVEIYPRVSKILKEEWSRTEIGQIKNV

Information d'application

Indications d'application: WB: 5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRIM59 Blocking Peptide, (ABIN940298), is also available for use as a blocking control in assays to test for specificity of this TRIM59 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM59 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRIM59

Antigène: TRIM59 (Tripartite Motif Containing 59 (TRIM59))

Autre désignation: TRIM59

Sujet: The function of TRIM59 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 44 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome