UNC93B1 anticorps

N° du produit ABIN630393

Cet anticorps anti-UNC93B1 Polyclonal Lapin (ABIN630393) détecte spécifiquement UNC93B1 dans WB. L’anticorps est réactif avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour UNC93B1 anticorps (ABIN630393)

Antigène: UNC93B1 (Unc-93 Homolog B1 (UNC93B1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UNC93B1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-UNC93B1 anticorps

Purification: Purified

Immunogène: UNC93 B1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKNVLAASAGGMLTYGVYLGLLQMQLILHYDETYREVKYGNMGLPDIDSK

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UNC93B1 Blocking Peptide, (ABIN940481), is also available for use as a blocking control in assays to test for specificity of this UNC93B1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UNC90 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UNC93B1

Antigène: UNC93B1 (Unc-93 Homolog B1 (UNC93B1))

Autre désignation: UNC93B1

Sujet: UNC93B1 is a protein with similarity to the C. elegans unc93 protein. The Unc93 protein is involved in the regulation or coordination of muscle contraction in the worm.

Poids moléculaire: 67 kDa (MW of target protein)

Pathways: Signalisation TLR, Activation of Innate immune Response, Toll-Like Receptors Cascades