TGFBI anticorps (C-Term)

N° du produit ABIN630399

Cet anticorps anti-TGFBI est un anticorps Lapin Polyclonal détectant TGFBI dans WB. Adapté pour Humain et Souris.

Aperçu rapide pour TGFBI anticorps (C-Term) (ABIN630399)

Antigène: TGFBI (Transforming Growth Factor, beta-Induced, 68kDa (TGFBI))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TGFBI est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TGFBI anticorps

Épitope: C-Term

Specificité: TGFBI antibody was raised against the C terminal of TGFBI

Purification: Purified

Immunogène: TGFBI antibody was raised using the C terminal of TGFBI corresponding to a region with amino acids LKNNVVSVNKEPVAEPDIMATNGVVHVITNVLQPPANRPQERGDELADSA

Information d'application

Indications d'application: WB: 1.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TGFBI Blocking Peptide, (ABIN940480), is also available for use as a blocking control in assays to test for specificity of this TGFBI antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TGFBI antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TGFBI

Antigène: TGFBI (Transforming Growth Factor, beta-Induced, 68kDa (TGFBI))

Autre désignation: TGFBI

Sujet: TGFBI Binds to type I, II, and IV collagens. This adhesion protein may play an important role in cell-collagen interactions. In cartilage, may be involved in endochondral bone formation.

Poids moléculaire: 46 kDa (MW of target protein)