Glucuronidase beta anticorps (C-Term)

N° du produit ABIN630431

L’anticorps Lapin Polyclonal anti-Glucuronidase beta a été validé pour WB et IHC. Il convient pour détecter Glucuronidase beta dans des échantillons de Humain.

Aperçu rapide pour Glucuronidase beta anticorps (C-Term) (ABIN630431)

Antigène: Glucuronidase beta (GUSB) (Glucuronidase, beta (GUSB))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Glucuronidase beta est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-Glucuronidase beta anticorps

Épitope: C-Term

Specificité: GUSB antibody was raised against the C terminal of GUSB

Purification: Purified

Immunogène: GUSB antibody was raised using the C terminal of GUSB corresponding to a region with amino acids VLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRYPHSVAKSQCLENSPF

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GUSB Blocking Peptide, (ABIN5613911), is also available for use as a blocking control in assays to test for specificity of this GUSB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GUSB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Glucuronidase beta

Antigène: Glucuronidase beta (GUSB) (Glucuronidase, beta (GUSB))

Autre désignation: GUSB

Sujet: GUSB plays an important role in the degradation of dermatan and keratan sulfates.

Poids moléculaire: 72 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process