Glucuronidase beta anticorps (C-Term)

N° du produit ABIN630431

Détail du produit anti-Glucuronidase beta anticorps

Antigène: Glucuronidase beta (GUSB) (Glucuronidase, beta (GUSB))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Glucuronidase beta est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: GUSB antibody was raised against the C terminal of GUSB

Purification: Purified

Immunogène: GUSB antibody was raised using the C terminal of GUSB corresponding to a region with amino acids VLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRYPHSVAKSQCLENSPF

Information d'application

Indications d'application: WB: 2.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GUSB Blocking Peptide, catalog no. 33R-9662, is also available for use as a blocking control in assays to test for specificity of this GUSB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GUSB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Glucuronidase beta

Antigène: Glucuronidase beta (GUSB) (Glucuronidase, beta (GUSB))

Autre désignation: GUSB (GUSB Produits)

Synonymes: anticorps GUSB, anticorps beta-GUS, anticorps gus, anticorps BG, anticorps MPS7, anticorps AI747421, anticorps Gur, anticorps Gus, anticorps Gus-r, anticorps Gus-s, anticorps Gus-t, anticorps Gus-u, anticorps Gut, anticorps asd, anticorps g, anticorps Ac2-223, anticorps si:ch211-160e1.7, anticorps si:ct573103.7, anticorps glucuronidase beta, anticorps beta-D-glucuronidase, anticorps beta-glucuronidase, anticorps beta glucuronidase, anticorps glucuronidase, beta, anticorps GUSB, anticorps bglR, anticorps SSO_RS14735, anticorps Glu, anticorps Gusb, anticorps gusb

Sujet: GUSB plays an important role in the degradation of dermatan and keratan sulfates.

Poids moléculaire: 72 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process