UGT1A1 anticorps (Middle Region)

N° du produit ABIN630449

L’anticorps anti-UGT1A1 Polyclonal Lapin est utilisé pour la détection de UGT1A1 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour UGT1A1 anticorps (Middle Region) (ABIN630449)

Antigène: UGT1A1 (UDP Glucuronosyltransferase 1 Family, Polypeptide A1 (UGT1A1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UGT1A1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-UGT1A1 anticorps

Épitope: Middle Region

Specificité: UGT1 A1 antibody was raised against the middle region of µgT1 1

Purification: Purified

Immunogène: UGT1 A1 antibody was raised using the middle region of µgT1 1 corresponding to a region with amino acids ASVWLFRSDFVKDYPRPIMPNMVFVGGINCLHQNPLSQEFEAYINASGEH

Information d'application

Indications d'application: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UGT1A1 Blocking Peptide, (ABIN936929), is also available for use as a blocking control in assays to test for specificity of this µgT1A1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgT0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UGT1A1

Antigène: UGT1A1 (UDP Glucuronosyltransferase 1 Family, Polypeptide A1 (UGT1A1))

Autre désignation: UGT1A1

Sujet: UGT1A1 is a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. The preferred substrate of this enzyme is bilirubin, although it also has moderate activity with simple phenols, flavones, and C18 steroids.

Poids moléculaire: 57 kDa (MW of target protein)

Pathways: Steroid Hormone Biosynthesis, Regulation of Lipid Metabolism by PPARalpha