SULF2 anticorps (C-Term)

N° du produit ABIN630454

Détail du produit anti-SULF2 anticorps

Antigène: SULF2 (Sulfatase 2 (SULF2))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SULF2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: SULF2 antibody was raised against the C terminal of SULF2

Purification: Purified

Immunogène: SULF2 antibody was raised using the C terminal of SULF2 corresponding to a region with amino acids DVLNQLHVQLMELRSCKGYKQCNPRTRNMDLGLKDGGSYEQYRQFQRRKW

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SULF2 Blocking Peptide, catalog no. 33R-2218, is also available for use as a blocking control in assays to test for specificity of this SULF2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SULF2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SULF2

Antigène: SULF2 (Sulfatase 2 (SULF2))

Autre désignation: SULF2 (SULF2 Produits)

Synonymes: anticorps Sulf1, anticorps zgc:55612, anticorps SULF2, anticorps si:dkeyp-84g9.1, anticorps wu:fb48e04, anticorps HSULF-2, anticorps xtsulf2, anticorps 2010004N24Rik, anticorps AU020235, anticorps MSulf-2, anticorps mKIAA1247, anticorps sulfatase 2a, anticorps sulfatase 2, anticorps extracellular sulfatase Sulf-2, anticorps sulfatase 2b, anticorps sulfatase 2 S homeolog, anticorps sulf2a, anticorps SULF2, anticorps LOC100540921, anticorps sulf2, anticorps sulf2b, anticorps sulf2.S, anticorps Sulf2

Sujet: Heparan sulfate proteoglycans (HSPGs) act as coreceptors for numerous heparin-binding growth factors and cytokines and are involved in cell signaling. Heparan sulfate 6-O-endosulfatases, such as SULF2, selectively remove 6-O-sulfate groups from heparan sulfate. This activity modulates the effects of heparan sulfate by altering binding sites for signaling molecules.

Poids moléculaire: 98 kDa (MW of target protein)