Butyrylcholinesterase anticorps (N-Term)

N° du produit ABIN630462

Cet anticorps anti-Butyrylcholinesterase est un anticorps Lapin Polyclonal détectant Butyrylcholinesterase dans WB et IHC. Adapté pour Humain, Chien et Souris.

Aperçu rapide pour Butyrylcholinesterase anticorps (N-Term) (ABIN630462)

Antigène: Butyrylcholinesterase (BCHE)

Reactivité: Humain, Chien, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Butyrylcholinesterase est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-Butyrylcholinesterase anticorps

Épitope: N-Term

Specificité: BCHE antibody was raised against the N terminal of BCHE

Purification: Purified

Immunogène: BCHE antibody was raised using the N terminal of BCHE corresponding to a region with amino acids SSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQ

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BCHE Blocking Peptide, (ABIN5612293), is also available for use as a blocking control in assays to test for specificity of this BCHE antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BCHE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Butyrylcholinesterase

Antigène: Butyrylcholinesterase (BCHE)

Autre désignation: BCHE

Sujet: Mutant alleles at the BCHE locus are responsible for suxamethonium sensitivity. Homozygous persons sustain prolonged apnea after administration of the muscle relaxant suxamethonium in connection with surgical anesthesia. The activity of pseudocholinesterase in the serum is low and its substrate behavior is atypical. In the absence of the relaxant, the homozygote is at no known disadvantage.

Poids moléculaire: 68 kDa (MW of target protein)

Pathways: Peptide Hormone Metabolism