TOR1B anticorps

N° du produit ABIN630472

Détail du produit anti-TOR1B anticorps

Antigène: TOR1B (Torsin Family 1, Member B (Torsin B) (TOR1B))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TOR1B est non-conjugé

Application: Western Blotting (WB)

Purification: Purified

Immunogène: TOR1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids VFNNKHSGLWHSGLIDKNLIDYFIPFLPLEYRHVKMCVRAEMRARGSAID

Information d'application

Indications d'application: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TOR1B Blocking Peptide, catalog no. 33R-9534, is also available for use as a blocking control in assays to test for specificity of this TOR1B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TOR0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TOR1B

Antigène: TOR1B (Torsin Family 1, Member B (Torsin B) (TOR1B))

Autre désignation: TOR1B (TOR1B Produits)

Synonymes: anticorps MGC82811, anticorps tor1a, anticorps 2610016F05Rik, anticorps DQ1, anticorps torsinB, anticorps torsin family 1, member B (torsin B) L homeolog, anticorps torsin family 1, member B (torsin B), anticorps torsin family 1 member B, anticorps torsin family 1, member B, anticorps tor1b.L, anticorps tor1b, anticorps TOR1B, anticorps Tor1b

Sujet: TOR1B may serve as a molecular chaperone assisting in the proper folding of secreted and/or membrane proteins.

Poids moléculaire: 38 kDa (MW of target protein)