EMP2 anticorps (Middle Region)

N° du produit ABIN630488

Détail du produit anti-EMP2 anticorps

Antigène: EMP2 (Epithelial Membrane Protein 2 (EMP2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EMP2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: EMP2 antibody was raised against the middle region of EMP2

Purification: Purified

Immunogène: EMP2 antibody was raised using the middle region of EMP2 corresponding to a region with amino acids IQLMSCLCVMIAASIYTDRREDIHDKNAKFYPVTREGSYGYSYILAWVAF

Information d'application

Indications d'application: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EMP2 Blocking Peptide, catalog no. 33R-4116, is also available for use as a blocking control in assays to test for specificity of this EMP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EMP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EMP2

Antigène: EMP2 (Epithelial Membrane Protein 2 (EMP2))

Autre désignation: EMP2 (EMP2 Produits)

Synonymes: anticorps MGC52916, anticorps MGC130799, anticorps MGC69514, anticorps emp2, anticorps XMP, anticorps epithelial membrane protein 2 L homeolog, anticorps epithelial membrane protein 2, anticorps emp2.L, anticorps emp2, anticorps EMP2, anticorps Emp2

Sujet: Epithelial membrane protein-2 (EMP2) is a member of the four transmembrane superfamily (TM4SF) and is thought to mediate trafficking of diverse proteins such as alpha6beta1 integrin and MHC class I to lipid raft microdomains. EMP2 has also recently been recognised as a putative tumor suppressor gene in certain model systems.

Poids moléculaire: 18 kDa (MW of target protein)