CCDC46 anticorps (C-Term)

N° du produit ABIN630527

L’anticorps Lapin Polyclonal anti-CCDC46 a été validé pour WB. Il convient pour détecter CCDC46 dans des échantillons de Humain.

Aperçu rapide pour CCDC46 anticorps (C-Term) (ABIN630527)

Antigène: CCDC46 (Coiled-Coil Domain Containing 46 (CCDC46))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CCDC46 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CCDC46 anticorps

Épitope: C-Term

Specificité: CCDC46 antibody was raised against the C terminal of CCDC46

Purification: Affinity purified

Immunogène: CCDC46 antibody was raised using the C terminal of CCDC46 corresponding to a region with amino acids IEKEYTQKLAKSSQIIAELQTTISSLKEENSQQQLAAERRLQDVRQKFED

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CCDC46 Blocking Peptide, (ABIN939328), is also available for use as a blocking control in assays to test for specificity of this CCDC46 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCDC46 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CCDC46

Antigène: CCDC46 (Coiled-Coil Domain Containing 46 (CCDC46))

Autre désignation: CCDC46

Sujet: CCDC46 is a protein with filament, myosin tail and ATPase domains. Orthologs of the gene exist in mouse, rat and chimp.

Poids moléculaire: 23 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome