TPI1 anticorps (N-Term)

N° du produit ABIN630577

Cet anticorps Lapin Polyclonal détecte spécifiquement TPI1 dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour TPI1 anticorps (N-Term) (ABIN630577)

Antigène: TPI1 (Triosephosphate Isomerase 1 (TPI1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TPI1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TPI1 anticorps

Épitope: N-Term

Specificité: TPI1 antibody was raised against the N terminal of TPI1

Purification: Affinity purified

Immunogène: TPI1 antibody was raised using the N terminal of TPI1 corresponding to a region with amino acids MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYID

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TPI1 Blocking Peptide, (ABIN5616740), is also available for use as a blocking control in assays to test for specificity of this TPI1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPI1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TPI1

Antigène: TPI1 (Triosephosphate Isomerase 1 (TPI1))

Autre désignation: TPI1

Sujet: TPI1 belongs to the triosephosphate isomerase family. Defects in TPI1 are the cause of triosephosphate isomerase deficiency (TPI deficiency) . TPI deficiency is an autosomal recessive disorder. It is the most severe clinical disorder of glycolysis. It is associated with neonatal jaundice, chronic hemolytic anemia, progressive neuromuscular dysfunction, cardiomyopathy and increased susceptibility to infection.

Poids moléculaire: 27 kDa (MW of target protein)

Pathways: Cell RedoxHomeostasis