GUK1 anticorps (Middle Region)

N° du produit ABIN630582

Cet anticorps anti-GUK1 est un anticorps Lapin Polyclonal détectant GUK1 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour GUK1 anticorps (Middle Region) (ABIN630582)

Antigène: GUK1 (Guanylate Kinase 1 (GUK1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GUK1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-GUK1 anticorps

Épitope: Middle Region

Specificité: GUK1 antibody was raised against the middle region of GUK1

Purification: Affinity purified

Immunogène: GUK1 antibody was raised using the middle region of GUK1 corresponding to a region with amino acids IEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GUK1 Blocking Peptide, (ABIN939325), is also available for use as a blocking control in assays to test for specificity of this GUK1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GUK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GUK1

Antigène: GUK1 (Guanylate Kinase 1 (GUK1))

Autre désignation: GUK1

Sujet: GUK1 is essential for recycling GMP and indirectly, cGMP.

Poids moléculaire: 22 kDa (MW of target protein)

Pathways: Nucleotide Phosphorylation, ER-Nucleus Signaling, Ribonucleoside Biosynthetic Process