PDSS2 anticorps
-
- Antigène Voir toutes PDSS2 Anticorps
- PDSS2 (Prenyl (Decaprenyl) Diphosphate Synthase, Subunit 2 (PDSS2))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PDSS2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- PDSS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids IKAGKGVTSAIDLCRYHGNKALEALESFPPSEARSALENIVFAVTRFS
- Top Product
- Discover our top product PDSS2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PDSS2 Blocking Peptide, catalog no. 33R-4010, is also available for use as a blocking control in assays to test for specificity of this PDSS2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDSS2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PDSS2 (Prenyl (Decaprenyl) Diphosphate Synthase, Subunit 2 (PDSS2))
- Autre désignation
- PDSS2 (PDSS2 Produits)
- Synonymes
- anticorps dlp1, anticorps C6orf210, anticorps COQ10D3, anticorps DLP1, anticorps bA59I9.3, anticorps hDLP1, anticorps zgc:92156, anticorps 5430420P03Rik, anticorps Gm60, anticorps Plmp, anticorps kd, anticorps mDLP1, anticorps decaprenyl diphosphate synthase subunit 2, anticorps prenyl (decaprenyl) diphosphate synthase, subunit 2, anticorps decaprenyl-diphosphate synthase subunit 2, anticorps decaprenyl diphosphate synthase subunit 2 Dlp1, anticorps prenyl (solanesyl) diphosphate synthase, subunit 2, anticorps PDSS2, anticorps pdss2, anticorps CpipJ_CPIJ016311, anticorps SJAG_01865, anticorps Tsp_08290, anticorps Pdss2
- Sujet
- The isoprenoid chain of ubiquinone (coenzyme Q) varies in length between species and is determined by trans-polyprenyl diphosphate synthase. Humans possess a heterotetrameric decaprenyl diphosphate synthase composed of DPS1 and DLP1 (PDSS2) that produces Q10 ubiquinone.
- Poids moléculaire
- 44 kDa (MW of target protein)
-