PDSS2 anticorps

N° du produit ABIN630585

Cet anticorps anti-PDSS2 Polyclonal Lapin (ABIN630585) détecte spécifiquement PDSS2 dans WB. L’anticorps est réactif avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour PDSS2 anticorps (ABIN630585)

Antigène: PDSS2 (Prenyl (Decaprenyl) Diphosphate Synthase, Subunit 2 (PDSS2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PDSS2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PDSS2 anticorps

Purification: Affinity purified

Immunogène: PDSS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids IKAGKGVTSAIDLCRYHGNKALEALESFPPSEARSALENIVFAVTRFS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PDSS2 Blocking Peptide, (ABIN939396), is also available for use as a blocking control in assays to test for specificity of this PDSS2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDSS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PDSS2

Antigène: PDSS2 (Prenyl (Decaprenyl) Diphosphate Synthase, Subunit 2 (PDSS2))

Autre désignation: PDSS2

Sujet: The isoprenoid chain of ubiquinone (coenzyme Q) varies in length between species and is determined by trans-polyprenyl diphosphate synthase. Humans possess a heterotetrameric decaprenyl diphosphate synthase composed of DPS1 and DLP1 (PDSS2) that produces Q10 ubiquinone.

Poids moléculaire: 44 kDa (MW of target protein)