CBP anticorps

N° du produit ABIN630600

Cet anticorps anti-CBP est un anticorps Lapin Polyclonal détectant CBP dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour CBP anticorps (ABIN630600)

Antigène: CBP (CREBBP) (CREB Binding Protein (CREBBP))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CBP est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-CBP anticorps

Purification: Affinity purified

Immunogène: CREBBP antibody was raised using a synthetic peptide corresponding to a region with amino acids TPAASQALNPQAQKQVGLATSSPATSQTGPGICMNANFNQTHPGLLNSNS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CREBBP Blocking Peptide, (ABIN5612996), is also available for use as a blocking control in assays to test for specificity of this CREBBP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CREBBP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CBP

Antigène: CBP (CREBBP) (CREB Binding Protein (CREBBP))

Autre désignation: CREBBP

Sujet: CREBBP is involved in the transcriptional coactivation of many different transcription factors. First isolated as a nuclear protein that binds to cAMP-response element binding protein (CREB), this gene is now known to play critical roles in embryonic development, growth control, and homeostasis by coupling chromatin remodeling to transcription factor recognition. CREBBP has intrinsic histone acetyltransferase activity and also acts as a scaffold to stabilize additional protein interactions with the transcription complex.

Poids moléculaire: 261 kDa (MW of target protein)

Pathways: TCR Signaling, Interferon-gamma Pathway, Stem Cell Maintenance, Chromatin Binding, Regulation of Lipid Metabolism by PPARalpha