CBP anticorps
-
- Antigène Voir toutes CBP (CREBBP) Anticorps
- CBP (CREBBP) (CREB Binding Protein (CREBBP))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CBP est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- CREBBP antibody was raised using a synthetic peptide corresponding to a region with amino acids TPAASQALNPQAQKQVGLATSSPATSQTGPGICMNANFNQTHPGLLNSNS
- Top Product
- Discover our top product CREBBP Anticorps primaire
-
anti-CREB Binding Protein (CREBBP) (C-Term) antibody
KO Validated CREBBP Reactivité: Humain WB, IF, IP, IHC (p), ICC, ChIP Hôte: Lapin Polyclonal unconjugated
anti-CREB Binding Protein (CREBBP) (C-Term) antibodyCREBBP Reactivité: Humain, Souris, Rat WB, IHC, ELISA, IF, ICC Hôte: Lapin Polyclonal unconjugated
anti-CREB Binding Protein (CREBBP) (AA 951-1050) antibodyCREBBP Reactivité: Humain WB, ELISA, IF, PLA Hôte: Souris Monoclonal 2H5 unconjugated
anti-CREB Binding Protein (CREBBP) (AA 1000-1100) antibody (Atto 594)CREBBP Reactivité: Humain WB, IHC Hôte: Lapin Polyclonal Atto 594
anti-CREB Binding Protein (CREBBP) (AA 1000-1100) antibody (Atto 390)CREBBP Reactivité: Humain WB, IHC Hôte: Lapin Polyclonal Atto 390
anti-CREB Binding Protein (CREBBP) (AA 1000-1100) antibody (HRP)CREBBP Reactivité: Humain WB, IHC Hôte: Lapin Polyclonal HRP
anti-CREB Binding Protein (CREBBP) (AA 1000-1100) antibody (FITC)CREBBP Reactivité: Humain WB, IHC Hôte: Lapin Polyclonal FITC
anti-CREB Binding Protein (CREBBP) (AA 1000-1100) antibody (Biotin)CREBBP Reactivité: Humain WB, IHC Hôte: Lapin Polyclonal Biotin
anti-CREB Binding Protein (CREBBP) (AA 1000-1100) antibody (PE)CREBBP Reactivité: Humain WB, IHC Hôte: Lapin Polyclonal PE
anti-CREB Binding Protein (CREBBP) (AA 144-193) antibodyCREBBP Reactivité: Humain, Souris, Rat, Boeuf (Vache), Chien, Poulet, Cobaye, Cheval, Lapin WB, IHC, IHC (p) Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CREBBP Blocking Peptide, catalog no. 33R-9216, is also available for use as a blocking control in assays to test for specificity of this CREBBP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CREBBP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CBP (CREBBP) (CREB Binding Protein (CREBBP))
- Autre désignation
- CREBBP (CREBBP Produits)
- Synonymes
- anticorps CBP, anticorps KAT3A, anticorps RSTS, anticorps AW558298, anticorps CBP/p300, anticorps p300/CBP, anticorps RTS, anticorps cbp, anticorps crebbp, anticorps kat3a, anticorps rsts, anticorps hmm291030, anticorps Nejire, anticorps CREB binding protein, anticorps CREB binding protein L homeolog, anticorps histone acetyltransferase p300, anticorps CREBBP, anticorps Crebbp, anticorps crebbp.L, anticorps LOC100123220
- Sujet
- CREBBP is involved in the transcriptional coactivation of many different transcription factors. First isolated as a nuclear protein that binds to cAMP-response element binding protein (CREB), this gene is now known to play critical roles in embryonic development, growth control, and homeostasis by coupling chromatin remodeling to transcription factor recognition. CREBBP has intrinsic histone acetyltransferase activity and also acts as a scaffold to stabilize additional protein interactions with the transcription complex.
- Poids moléculaire
- 261 kDa (MW of target protein)
- Pathways
- TCR Signaling, Interferon-gamma Pathway, Stem Cell Maintenance, Chromatin Binding, Regulation of Lipid Metabolism by PPARalpha
-
