TXNIP anticorps (C-Term)

N° du produit ABIN630604

Cet anticorps Lapin Polyclonal détecte spécifiquement TXNIP dans WB. Il présente une réactivité envers Humain, Souris et Rat.

Aperçu rapide pour TXNIP anticorps (C-Term) (ABIN630604)

Antigène: TXNIP (Thioredoxin Interacting Protein (TXNIP))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TXNIP est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TXNIP anticorps

Épitope: C-Term

Specificité: TXNIP antibody was raised against the C terminal of TXNIP

Purification: Affinity purified

Immunogène: TXNIP antibody was raised using the C terminal of TXNIP corresponding to a region with amino acids DTPEAPPCYMDVIPEDHRLESPTTPLLDDMDGSQDSPIFMYAPEFKFMPP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TXNIP Blocking Peptide, (ABIN937587), is also available for use as a blocking control in assays to test for specificity of this TXNIP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TXNIP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TXNIP

Antigène: TXNIP (Thioredoxin Interacting Protein (TXNIP))

Autre désignation: TXNIP

Sujet: TXNIP may act as an oxidative stress mediator by inhibiting thioredoxin activity or by limiting its bioavailability. It interacts with COPS5 and restores COPS5-induced suppression of CDKN1B stability, blocking the COPS5-mediated translocation of CDKN1B from the nucleus to the cytoplasm. It functions as a transcriptional repressor, possibly by acting as a bridge molecule between transcription factors and corepressor complexes, and over-expression will induce G0/G1 cell cycle arrest. It is required for the maturation of natural killer cells.

Poids moléculaire: 44 kDa (MW of target protein)

Pathways: Protein targeting to Nucleus, Platelet-derived growth Factor Receptor Signaling, Inflammasome