TXNIP anticorps (C-Term)
-
- Antigène Voir toutes TXNIP Anticorps
- TXNIP (Thioredoxin Interacting Protein (TXNIP))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TXNIP est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TXNIP antibody was raised against the C terminal of TXNIP
- Purification
- Affinity purified
- Immunogène
- TXNIP antibody was raised using the C terminal of TXNIP corresponding to a region with amino acids DTPEAPPCYMDVIPEDHRLESPTTPLLDDMDGSQDSPIFMYAPEFKFMPP
- Top Product
- Discover our top product TXNIP Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TXNIP Blocking Peptide, catalog no. 33R-2201, is also available for use as a blocking control in assays to test for specificity of this TXNIP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TXNIP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TXNIP (Thioredoxin Interacting Protein (TXNIP))
- Autre désignation
- TXNIP (TXNIP Produits)
- Synonymes
- anticorps EST01027, anticorps HHCPA78, anticorps THIF, anticorps VDUP1, anticorps Gm348, anticorps Trf3, anticorps TBP2, anticorps TRF3, anticorps 1200008J08Rik, anticorps AA682105, anticorps Hyplip1, anticorps Tbp-2, anticorps Vdup1, anticorps sb:cb368, anticorps txnip, anticorps thioredoxin interacting protein, anticorps TATA box binding protein like 2, anticorps TATA-box binding protein like 2, anticorps thioredoxin interacting protein L homeolog, anticorps thioredoxin interacting protein a, anticorps TXNIP, anticorps Tbpl2, anticorps TBPL2, anticorps Txnip, anticorps txnip.L, anticorps txnip, anticorps txnipa
- Sujet
- TXNIP may act as an oxidative stress mediator by inhibiting thioredoxin activity or by limiting its bioavailability. It interacts with COPS5 and restores COPS5-induced suppression of CDKN1B stability, blocking the COPS5-mediated translocation of CDKN1B from the nucleus to the cytoplasm. It functions as a transcriptional repressor, possibly by acting as a bridge molecule between transcription factors and corepressor complexes, and over-expression will induce G0/G1 cell cycle arrest. It is required for the maturation of natural killer cells.
- Poids moléculaire
- 44 kDa (MW of target protein)
- Pathways
- Protein targeting to Nucleus, Platelet-derived growth Factor Receptor Signaling, Inflammasome
-