EGR1 anticorps (Middle Region)

N° du produit ABIN630613

Cet anticorps Lapin Polyclonal détecte spécifiquement EGR1 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour EGR1 anticorps (Middle Region) (ABIN630613)

Antigène: EGR1 (Early Growth Response 1 (EGR1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EGR1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-EGR1 anticorps

Épitope: Middle Region

Specificité: EGR1 antibody was raised against the middle region of EGR1

Purification: Affinity purified

Immunogène: EGR1 antibody was raised using the middle region of EGR1 corresponding to a region with amino acids PSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EGR1 Blocking Peptide, (ABIN5613319), is also available for use as a blocking control in assays to test for specificity of this EGR1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EGR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EGR1

Antigène: EGR1 (Early Growth Response 1 (EGR1))

Autre désignation: EGR1

Sujet: Early Growth Response Protein 1 (EGR1, Krox-24 protein, nerve growth factor-induced protein A, Transcription factor ETR103, Zinc finger protein 225) belongs to the EGR family of C2H2-type zinc-finger proteins.

Poids moléculaire: 57 kDa (MW of target protein)

Pathways: Regulation of Carbohydrate Metabolic Process, Regulation of long-term Neuronal Synaptic Plasticity