EGR1 anticorps (Middle Region)

N° du produit ABIN630613

Détail du produit anti-EGR1 anticorps

Antigène: EGR1 (Early Growth Response 1 (EGR1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EGR1 est non-conjugé

Application: Western Blotting (WB)

Specificité: EGR1 antibody was raised against the middle region of EGR1

Purification: Affinity purified

Immunogène: EGR1 antibody was raised using the middle region of EGR1 corresponding to a region with amino acids PSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EGR1 Blocking Peptide, catalog no. 33R-7362, is also available for use as a blocking control in assays to test for specificity of this EGR1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EGR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EGR1

Antigène: EGR1 (Early Growth Response 1 (EGR1))

Autre désignation: EGR1 (EGR1 Produits)

Synonymes: anticorps AT225, anticorps G0S30, anticorps KROX-24, anticorps NGFI-A, anticorps TIS8, anticorps ZIF-268, anticorps ZNF225, anticorps A530045N19Rik, anticorps ETR103, anticorps Egr-1, anticorps Krox-1, anticorps Krox-24, anticorps Krox24, anticorps NGF1-A, anticorps NGFIA, anticorps Zenk, anticorps Zfp-6, anticorps Zif268, anticorps egr, anticorps Ngf1, anticorps Ngfi, anticorps zif-268, anticorps EGR1, anticorps EGR-1-A, anticorps Xegr-1, anticorps at225, anticorps egr-1, anticorps egr1, anticorps g0s30, anticorps krox-24, anticorps ngfi-a, anticorps tis8, anticorps znf225, anticorps krox24, anticorps wu:fj64b05, anticorps wu:fq25f01, anticorps EGR-1, anticorps zenk, anticorps EGR-1-B, anticorps egr1-a, anticorps egr1-b, anticorps early growth response 1, anticorps early growth response protein 1 (egr-1), anticorps early growth response 1 L homeolog, anticorps early growth response 1 S homeolog, anticorps EGR1, anticorps CNK00890, anticorps Egr1, anticorps egr1.L, anticorps egr1, anticorps egr1.S

Sujet: Early Growth Response Protein 1 (EGR1, Krox-24 protein, nerve growth factor-induced protein A, Transcription factor ETR103, Zinc finger protein 225) belongs to the EGR family of C2H2-type zinc-finger proteins.

Poids moléculaire: 57 kDa (MW of target protein)

Pathways: Regulation of Carbohydrate Metabolic Process, Regulation of long-term Neuronal Synaptic Plasticity