CHFR anticorps (N-Term)

N° du produit ABIN630645

Détail du produit anti-CHFR anticorps

Antigène: CHFR (Checkpoint with Forkhead and Ring Finger Domains (CHFR))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CHFR est non-conjugé

Application: Western Blotting (WB)

Specificité: CHFR antibody was raised against the N terminal of CHFR

Purification: Affinity purified

Immunogène: CHFR antibody was raised using the N terminal of CHFR corresponding to a region with amino acids REWTIGRRRGCDLSFPSNKLVSGDHCRIVVDEKSGQVTLEDTSTSGTVIN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CHFR Blocking Peptide, catalog no. 33R-7895, is also available for use as a blocking control in assays to test for specificity of this CHFR antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHFR antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CHFR

Antigène: CHFR (Checkpoint with Forkhead and Ring Finger Domains (CHFR))

Autre désignation: CHFR (CHFR Produits)

Synonymes: anticorps RNF116, anticorps RNF196, anticorps CHFR, anticorps fc43f10, anticorps si:dkey-69h6.7, anticorps wu:fc43f10, anticorps rnf116, anticorps rnf196, anticorps 5730484M20Rik, anticorps C230082M18, anticorps checkpoint with forkhead and ring finger domains, anticorps checkpoint with forkhead and ring finger domains, E3 ubiquitin protein ligase, anticorps checkpoint with forkhead and ring finger domains, E3 ubiquitin protein ligase L homeolog, anticorps CHFR, anticorps chfr, anticorps Chfr, anticorps chfr.L

Sujet: CHFR is an E3 ubiquitin-protein ligase required to transiently arrest cells in early prophase when they are exposed to microtubule poisons. It acts in early prophase before chromosome condensation, when the centrosome moves apart from each other along the periphery of the nucleus. CHFR probably promotes the formation of 'Lys-63'-linked polyubiquitin chains and functions with the specific ubiquitin-conjugating UBC13-MMS2 (UBE2N-UBE2V2) heterodimer. Substrates that are polyubiquitinated at 'Lys-63' are usually not targeted for degradation, but are rather involved in signaling cellular stress. This suggests that it may be involved in signaling the presence of mitotic stress caused by microtubule poisons.

Poids moléculaire: 69 kDa (MW of target protein)