PDE7B anticorps (Middle Region)

N° du produit ABIN630666

Détail du produit anti-PDE7B anticorps

Antigène: PDE7B (phosphodiesterase 7B (PDE7B))

Épitope: Middle Region

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PDE7B est non-conjugé

Application: Western Blotting (WB)

Specificité: PDE7 B antibody was raised against the middle region of PDE7

Purification: Affinity purified

Immunogène: PDE7 B antibody was raised using the middle region of PDE7 corresponding to a region with amino acids IGMLRESRLLAHLPKEMTQDIEQQLGSLILATDINRQNEFLTRLKAHLHN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PDE7B Blocking Peptide, catalog no. 33R-3973, is also available for use as a blocking control in assays to test for specificity of this PDE7B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDE0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PDE7B

Antigène: PDE7B (phosphodiesterase 7B (PDE7B))

Autre désignation: PDE7B (PDE7B Produits)

Synonymes: anticorps PDE7B, anticorps ba472e5.1, anticorps bA472E5.1, anticorps phosphodiesterase 7B, anticorps PDE7B, anticorps pde7b, anticorps Pde7b

Sujet: The 3',5'-cyclic nucleotides cAMP and cGMP function as second messengers in a wide variety of signal transduction pathways.

Poids moléculaire: 52 kDa (MW of target protein)

Pathways: cAMP Metabolic Process