H2AFY anticorps (N-Term)

N° du produit ABIN630688

Détail du produit anti-H2AFY anticorps

Antigène: H2AFY (H2A Histone Family, Member Y (H2AFY))

Épitope: N-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp H2AFY est non-conjugé

Application: Western Blotting (WB)

Specificité: H2 AFY antibody was raised against the N terminal of H2 FY

Purification: Affinity purified

Immunogène: H2 AFY antibody was raised using the N terminal of H2 FY corresponding to a region with amino acids HPKYRIGVGAPVYMAAVLEYLTAEILELAGNAARDNKKGRVTPRHILLAV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

H2AFY Blocking Peptide, catalog no. 33R-3812, is also available for use as a blocking control in assays to test for specificity of this H2AFY antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of H0 FY antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur H2AFY

Antigène: H2AFY (H2A Histone Family, Member Y (H2AFY))

Autre désignation: H2AFY (H2AFY Produits)

Synonymes: anticorps H2A.y, anticorps H2A/y, anticorps H2AF12M, anticorps H2AFJ, anticorps MACROH2A1.1, anticorps mH2A1, anticorps macroH2A1.2, anticorps mH2a1, anticorps macroH2A1, anticorps wu:fa93c12, anticorps zgc:136891, anticorps h2a.y, anticorps h2a/y, anticorps h2af12m, anticorps h2afj, anticorps macroh2a, anticorps mh2a1, anticorps core histone macro-H2A.1, anticorps H2A histone family, member Y, anticorps H2A histone family member Y, anticorps H2A histone family member Y L homeolog, anticorps LOC100230612, anticorps H2AFY, anticorps LOC481514, anticorps H2afy, anticorps h2afy, anticorps h2afy.L

Sujet: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. H2AFY is a member of the histone H2A family. It replaces conventional H2A histones in a subset of nucleosomes where it represses transcription and participates in stable X chromosome inactivation. Alternative splicing results in multiple transcript variants encoding different isoforms.

Poids moléculaire: 39 kDa (MW of target protein)