IMPDH2 anticorps
-
- Antigène Voir toutes IMPDH2 Anticorps
- IMPDH2 (IMP (Inosine 5'-Monophosphate) Dehydrogenase 2 (IMPDH2))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp IMPDH2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- IMPDH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SCQDIGAKSLTQVRAMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF
- Top Product
- Discover our top product IMPDH2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
IMPDH2 Blocking Peptide, catalog no. 33R-8336, is also available for use as a blocking control in assays to test for specificity of this IMPDH2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IMPDH2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- IMPDH2 (IMP (Inosine 5'-Monophosphate) Dehydrogenase 2 (IMPDH2))
- Autre désignation
- IMPDH2 (IMPDH2 Produits)
- Synonymes
- anticorps imp2, anticorps impd2, anticorps impdh-ii, anticorps impdh2, anticorps IMPD2, anticorps IMPDH-II, anticorps IMPD 2, anticorps IMPDH 2, anticorps cb635, anticorps wu:fb64g02, anticorps wu:fc43f09, anticorps IMPD, anticorps inosine monophosphate dehydrogenase 2, anticorps IMP (inosine 5'-monophosphate) dehydrogenase 2, anticorps inosine 5'-phosphate dehydrogenase 2, anticorps IMPDH2, anticorps impdh2.S, anticorps impdh2, anticorps Impdh2
- Sujet
- IMPDH2 is the rate-limiting enzyme in the de novo guanine nucleotide biosynthesis. It is thus involved in maintaining cellular guanine deoxy- and ribonucleotide pools needed for DNA and RNA synthesis. It catalyzes the NAD-dependent oxidation of inosine-5'-monophosphate into xanthine-5'-monophosphate, which is then converted into guanosine-5'-monophosphate. IMPDH2 is up-regulated in some neoplasms, suggesting it may play a role in malignant transformation.
- Poids moléculaire
- 56 kDa (MW of target protein)
- Pathways
- Ribonucleoside Biosynthetic Process, SARS-CoV-2 Protein Interactome
-