IMPDH2 anticorps

N° du produit ABIN630710

Détail du produit anti-IMPDH2 anticorps

Antigène: IMPDH2 (IMP (Inosine 5'-Monophosphate) Dehydrogenase 2 (IMPDH2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IMPDH2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: IMPDH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SCQDIGAKSLTQVRAMMYSGELKFEKRTSSAQVEGGVHSLHSYEKRLF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

IMPDH2 Blocking Peptide, catalog no. 33R-8336, is also available for use as a blocking control in assays to test for specificity of this IMPDH2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IMPDH2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IMPDH2

Antigène: IMPDH2 (IMP (Inosine 5'-Monophosphate) Dehydrogenase 2 (IMPDH2))

Autre désignation: IMPDH2 (IMPDH2 Produits)

Synonymes: anticorps imp2, anticorps impd2, anticorps impdh-ii, anticorps impdh2, anticorps IMPD2, anticorps IMPDH-II, anticorps IMPD 2, anticorps IMPDH 2, anticorps cb635, anticorps wu:fb64g02, anticorps wu:fc43f09, anticorps IMPD, anticorps inosine monophosphate dehydrogenase 2, anticorps IMP (inosine 5'-monophosphate) dehydrogenase 2, anticorps inosine 5'-phosphate dehydrogenase 2, anticorps IMPDH2, anticorps impdh2.S, anticorps impdh2, anticorps Impdh2

Sujet: IMPDH2 is the rate-limiting enzyme in the de novo guanine nucleotide biosynthesis. It is thus involved in maintaining cellular guanine deoxy- and ribonucleotide pools needed for DNA and RNA synthesis. It catalyzes the NAD-dependent oxidation of inosine-5'-monophosphate into xanthine-5'-monophosphate, which is then converted into guanosine-5'-monophosphate. IMPDH2 is up-regulated in some neoplasms, suggesting it may play a role in malignant transformation.

Poids moléculaire: 56 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process, SARS-CoV-2 Protein Interactome