GAPDH anticorps (N-Term)

N° du produit ABIN630723

Cet anticorps anti-GAPDH est un anticorps Lapin Polyclonal détectant GAPDH dans WB. Adapté pour Humain et Chien. Ce Primary Antibody a été cité dans 2+ publications.

Aperçu rapide pour GAPDH anticorps (N-Term) (ABIN630723)

Antigène: GAPDH (Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH))

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GAPDH est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-GAPDH anticorps

Épitope: N-Term

Specificité: GAPDH antibody was raised against the N terminal of GAPDH

Purification: Affinity purified

Immunogène: GAPDH antibody was raised using the N terminal of GAPDH corresponding to a region with amino acids IDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQERDPSKIKW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GAPDH Blocking Peptide, (ABIN939307), is also available for use as a blocking control in assays to test for specificity of this GAPDH antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAPDH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Références pour anticorps anti-GAPDH (ABIN630723)

Kuroda, Ishii, Uematsu, Ohata, Coban, Akira, Aritake, Urade, Morimoto: "Silica crystals and aluminum salts regulate the production of prostaglandin in macrophages via NALP3 inflammasome-independent mechanisms." dans: Immunity, Vol. 34, Issue 4, pp. 514-26, (2011) (PubMed).

Shi, Zhang, Yang, Zhang, Wei: "ROCK1 plays an essential role in the transition from cardiac hypertrophy to failure in mice." dans: Journal of molecular and cellular cardiology, Vol. 49, Issue 5, pp. 819-28, (2010) (PubMed).

Détails sur GAPDH

Antigène: GAPDH (Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH))

Autre désignation: GAPDH

Sujet: GAPDH catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a tetramer of identical chains. Many pseudogenes similar to this locus are present in the human genome.

Poids moléculaire: 36 kDa (MW of target protein)