FAD Synthetase anticorps

N° du produit ABIN630740

L’anticorps Lapin Polyclonal anti-FAD Synthetase a été validé pour WB. Il convient pour détecter FAD Synthetase dans des échantillons de Humain, Souris et Rat.

Aperçu rapide pour FAD Synthetase anticorps (ABIN630740)

Antigène: FAD Synthetase

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAD Synthetase est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FAD Synthetase anticorps

Purification: Affinity purified

Immunogène: FLAD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGRSVTAGIIIVGDEILKGHTQDTNTFFLCRTLRSLGVQVCRVSVVPDEV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FLAD1 Blocking Peptide, (ABIN5613601), is also available for use as a blocking control in assays to test for specificity of this FLAD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLAD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAD Synthetase

Antigène: FAD Synthetase

Autre désignation: FLAD1

Sujet: FLAD1 catalyzes the adenylation of flavin mononucleotide (FMN) to form flavin adenine dinucleotide (FAD) coenzyme.

Poids moléculaire: 65 kDa (MW of target protein)