BLVRB anticorps (Middle Region)

N° du produit ABIN630752

Détail du produit anti-BLVRB anticorps

Antigène: BLVRB (Flavin Reductase (BLVRB))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp BLVRB est non-conjugé

Application: Western Blotting (WB)

Specificité: BLVRB antibody was raised against the middle region of BLVRB

Purification: Affinity purified

Immunogène: BLVRB antibody was raised using the middle region of BLVRB corresponding to a region with amino acids GLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

BLVRB Blocking Peptide, catalog no. 33R-3403, is also available for use as a blocking control in assays to test for specificity of this BLVRB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BLVRB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur BLVRB

Antigène: BLVRB (Flavin Reductase (BLVRB))

Autre désignation: BLVRB (BLVRB Produits)

Synonymes: anticorps BVRB, anticorps FLR, anticorps SDR43U1, anticorps biliverdin reductase B (flavin reductase (NADPH)), anticorps biliverdin reductase B, anticorps Blvrb, anticorps BLVRB

Sujet: BLVRB catalyzes electron transfer from reduced pyridine nucleotides to flavins as well as methylene blue, pyrroloquinoline quinone, riboflavin, or methemoglobin. BLVRB has possible role in protecting cells from oxidative damage or in regulating iron metabolism. In the liver, BLVRB converts biliverdin to bilirubin.

Poids moléculaire: 22 kDa (MW of target protein)