Myosin IC anticorps (N-Term)

N° du produit ABIN630755

L’anticorps Lapin Polyclonal anti-Myosin IC a été validé pour WB. Il convient pour détecter Myosin IC dans des échantillons de Humain, Rat et Souris.

Aperçu rapide pour Myosin IC anticorps (N-Term) (ABIN630755)

Antigène: Myosin IC (MYO1C)

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Myosin IC est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Myosin IC anticorps

Épitope: N-Term

Specificité: Myosin Ic antibody was raised against the N terminal of MYO1 C

Purification: Affinity purified

Immunogène: Myosin Ic antibody was raised using the N terminal of MYO1 C corresponding to a region with amino acids NPVLEAFGNAKTLRNDNSSRFGKYMDVQFDFKGAPVGGHILSYLLEKSRV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Myosin Ic Blocking Peptide, (ABIN5614900), is also available for use as a blocking control in assays to test for specificity of this Myosin Ic antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MYO0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Myosin IC

Antigène: Myosin IC (MYO1C)

Autre désignation: Myosin Ic

Sujet: This gene encodes a member of the unconventional myosin protein family, which are actin-based molecular motors. The protein is found in the cytoplasm, and one isoform with a unique N-terminus is also found in the nucleus.

Poids moléculaire: 113 kDa (MW of target protein)

Pathways: Platelet-derived growth Factor Receptor Signaling