LIN7C anticorps

N° du produit ABIN630769

Cet anticorps Lapin Polyclonal détecte spécifiquement LIN7C dans WB. Il présente une réactivité envers Humain, Rat et Souris.

Aperçu rapide pour LIN7C anticorps (ABIN630769)

Antigène: LIN7C (Lin-7 Homolog C (LIN7C))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LIN7C est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-LIN7C anticorps

Purification: Affinity purified

Immunogène: LIN7 C antibody was raised using a synthetic peptide corresponding to a region with amino acids MAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LIN7C Blocking Peptide, (ABIN5614458), is also available for use as a blocking control in assays to test for specificity of this LIN7C antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIN0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LIN7C

Antigène: LIN7C (Lin-7 Homolog C (LIN7C))

Autre désignation: LIN7C

Sujet: LIN7C plays a role in establishing and maintaining the asymmetric distribution of channels and receptors at the plasma membrane of polarized cells. It forms membrane-associated multiprotein complexes that may regulate delivery and recycling of proteins to the correct membrane domains.

Poids moléculaire: 22 kDa (MW of target protein)

Pathways: Synaptic Membrane