LIN7C anticorps
-
- Antigène Voir toutes LIN7C Anticorps
- LIN7C (Lin-7 Homolog C (LIN7C))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LIN7C est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- LIN7 C antibody was raised using a synthetic peptide corresponding to a region with amino acids MAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAV
- Top Product
- Discover our top product LIN7C Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LIN7C Blocking Peptide, catalog no. 33R-5599, is also available for use as a blocking control in assays to test for specificity of this LIN7C antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIN0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- LIN7C (Lin-7 Homolog C (LIN7C))
- Autre désignation
- LIN7C (LIN7C Produits)
- Synonymes
- anticorps LIN7C, anticorps fb75b09, anticorps wu:fb75b09, anticorps zgc:101881, anticorps LIN-7-C, anticorps LIN-7C, anticorps MALS-3, anticorps MALS3, anticorps VELI3, anticorps 9130007B12Rik, anticorps AI303698, anticorps AU019331, anticorps AW125731, anticorps D2Ertd520e, anticorps Veli3, anticorps lin-7 homolog C, crumbs cell polarity complex component, anticorps lin-7 homolog C L homeolog, anticorps lin-7 homolog C (C. elegans), anticorps LIN7C, anticorps lin7c.L, anticorps lin7c, anticorps Lin7c
- Sujet
- LIN7C plays a role in establishing and maintaining the asymmetric distribution of channels and receptors at the plasma membrane of polarized cells. It forms membrane-associated multiprotein complexes that may regulate delivery and recycling of proteins to the correct membrane domains.
- Poids moléculaire
- 22 kDa (MW of target protein)
- Pathways
- Synaptic Membrane
-