WWP2 anticorps (Middle Region)

N° du produit ABIN630775

Cet anticorps Lapin Polyclonal détecte spécifiquement WWP2 dans WB. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour WWP2 anticorps (Middle Region) (ABIN630775)

Antigène: WWP2 (WW Domain Containing E3 Ubiquitin Protein Ligase 2 (WWP2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp WWP2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-WWP2 anticorps

Épitope: Middle Region

Specificité: WWP2 antibody was raised against the middle region of WWP2

Purification: Affinity purified

Immunogène: WWP2 antibody was raised using the middle region of WWP2 corresponding to a region with amino acids SSASTDHDPLGPLPPGWEKRQDNGRVYYVNHNTRTTQWEDPRTQGMIQEP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

WWP2 Blocking Peptide, (ABIN5617031), is also available for use as a blocking control in assays to test for specificity of this WWP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WWP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur WWP2

Antigène: WWP2 (WW Domain Containing E3 Ubiquitin Protein Ligase 2 (WWP2))

Autre désignation: WWP2

Sujet: WWP2 is a member of the NEDD4-like protein family. The family of proteins is known to possess ubiquitin-protein ligase activity. WWP2 contains 4 tandem WW domains. The WW domain is a protein motif consisting of 35 to 40 amino acids and is characterized by 4 conserved aromatic residues. The WW domain may mediate specific protein-protein interactions. This gene encodes a member of the NEDD4-like protein family. The family of proteins is known to possess ubiquitin-protein ligase activity.

Poids moléculaire: 90 kDa (MW of target protein)

Pathways: Negative Regulation of Transporter Activity