ABAT anticorps (Middle Region)

N° du produit ABIN630787

Cet anticorps Lapin Polyclonal détecte spécifiquement ABAT dans WB. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour ABAT anticorps (Middle Region) (ABIN630787)

Antigène: ABAT (4-Aminobutyrate Aminotransferase (ABAT))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ABAT est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ABAT anticorps

Épitope: Middle Region

Specificité: ABAT antibody was raised against the middle region of ABAT

Purification: Affinity purified

Immunogène: ABAT antibody was raised using the middle region of ABAT corresponding to a region with amino acids IIVEPIQSEGGDNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ABAT Blocking Peptide, (ABIN939395), is also available for use as a blocking control in assays to test for specificity of this ABAT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABAT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ABAT

Antigène: ABAT (4-Aminobutyrate Aminotransferase (ABAT))

Autre désignation: ABAT

Sujet: 4-aminobutyrate aminotransferase (ABAT) is responsible for catabolism of gamma-aminobutyric acid (GABA), an important, mostly inhibitory neurotransmitter in the central nervous system, into succinic semialdehyde. The active enzyme is a homodimer of 50 kDa subunits complexed to pyridoxal-5-phosphate. ABAT in liver and brain is controlled by 2 codominant alleles with a frequency in a Caucasian population of 0.56 and 0.44. The ABAT deficiency phenotype includes psychomotor retardation, hypotonia, hyperreflexia, lethargy, refractory seizures, and EEG abnormalities.4-aminobutyrate aminotransferase (ABAT) is responsible for catabolism of gamma-aminobutyric acid (GABA), an important, mostly inhibitory neurotransmitter in the central nervous system, into succinic semialdehyde

Poids moléculaire: 55 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process