ABAT anticorps (Middle Region)

N° du produit ABIN630787

Détail du produit anti-ABAT anticorps

Antigène: ABAT (4-Aminobutyrate Aminotransferase (ABAT))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ABAT est non-conjugé

Application: Western Blotting (WB)

Specificité: ABAT antibody was raised against the middle region of ABAT

Purification: Affinity purified

Immunogène: ABAT antibody was raised using the middle region of ABAT corresponding to a region with amino acids IIVEPIQSEGGDNHASDDFFRKLRDIARKHGCAFLVDEVQTGGGCTGKFW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ABAT Blocking Peptide, catalog no. 33R-4009, is also available for use as a blocking control in assays to test for specificity of this ABAT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABAT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ABAT

Antigène: ABAT (4-Aminobutyrate Aminotransferase (ABAT))

Autre désignation: ABAT (ABAT Produits)

Synonymes: anticorps cb880, anticorps fj82a01, anticorps wu:fj82a01, anticorps BA0325, anticorps PSPTO0259, anticorps PSPTO0301, anticorps PSPTO1890, anticorps GABA-AT, anticorps GABAT, anticorps NPD009, anticorps GABA-T, anticorps L-AIBAT, anticorps 9630038C02Rik, anticorps AI255750, anticorps ENSMUSG00000051226, anticorps Gabaat, anticorps Gabat, anticorps Gm9851, anticorps I54, anticorps Laibat, anticorps X61497, anticorps beta-AlaAT, anticorps 4-aminobutyrate aminotransferase, anticorps 4-aminobutyrate--2-oxoglutarate transaminase, anticorps GABA aminotransferase PLP-dependent PuuE, anticorps 4-aminobutyrate aminotransferase, mitochondrial, anticorps aspartate aminotransferase family protein, anticorps 4-aminobutyrate aminotransferase S homeolog, anticorps ABAT, anticorps abat, anticorps gabT, anticorps puuE, anticorps gabT-1, anticorps gabT-2, anticorps gabT-3, anticorps CNE01830, anticorps Mmwyl1_0047, anticorps CpipJ_CPIJ008729, anticorps KCR_RS04555, anticorps Bcenmc03_4909, anticorps Hden_0972, anticorps Dbac_2000, anticorps Mesil_2400, anticorps Trad_0121, anticorps abat.S, anticorps Abat

Sujet: 4-aminobutyrate aminotransferase (ABAT) is responsible for catabolism of gamma-aminobutyric acid (GABA), an important, mostly inhibitory neurotransmitter in the central nervous system, into succinic semialdehyde. The active enzyme is a homodimer of 50 kDa subunits complexed to pyridoxal-5-phosphate. ABAT in liver and brain is controlled by 2 codominant alleles with a frequency in a Caucasian population of 0.56 and 0.44. The ABAT deficiency phenotype includes psychomotor retardation, hypotonia, hyperreflexia, lethargy, refractory seizures, and EEG abnormalities.4-aminobutyrate aminotransferase (ABAT) is responsible for catabolism of gamma-aminobutyric acid (GABA), an important, mostly inhibitory neurotransmitter in the central nervous system, into succinic semialdehyde

Poids moléculaire: 55 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process