DTX2 anticorps

N° du produit ABIN630801

Cet anticorps anti-DTX2 est un anticorps Lapin Polyclonal détectant DTX2 dans WB. Adapté pour Humain, Chien et Poisson zèbre (Danio rerio).

Aperçu rapide pour DTX2 anticorps (ABIN630801)

Antigène: DTX2 (Deltex Homolog 2 (DTX2))

Reactivité: Humain, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DTX2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DTX2 anticorps

Purification: Affinity purified

Immunogène: DTX2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDCGTILIVYSIPHGIQGPEHPNPGKPFTARGFPRQCYLPDNAQGRKVLE

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DTX2 Blocking Peptide, (ABIN937691), is also available for use as a blocking control in assays to test for specificity of this DTX2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DTX2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DTX2

Antigène: DTX2 (Deltex Homolog 2 (DTX2))

Autre désignation: DTX2

Sujet: DTX2 is a regulator of Notch signaling, a signaling pathway involved in cell-cell communications that regulates a broad spectrum of cell-fate determinations. DTX2 probably acts both as a positive and negative regulator of Notch, depending on the developmental and cell context and mediates the antineural activity of Notch, possibly by inhibiting the transcriptional activation mediated by MATCH1. It also functions as an ubiquitin ligase protein in vitro, suggesting that it may regulate the Notch pathway via some ubiquitin ligase activity.

Poids moléculaire: 62 kDa (MW of target protein)

Pathways: Signalisation Notch