DTX2 anticorps

N° du produit ABIN630801

Détail du produit anti-DTX2 anticorps

Antigène: DTX2 (Deltex Homolog 2 (DTX2))

Reactivité: Humain, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DTX2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: DTX2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDCGTILIVYSIPHGIQGPEHPNPGKPFTARGFPRQCYLPDNAQGRKVLE

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DTX2 Blocking Peptide, catalog no. 33R-2305, is also available for use as a blocking control in assays to test for specificity of this DTX2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DTX2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DTX2

Antigène: DTX2 (Deltex Homolog 2 (DTX2))

Autre désignation: DTX2 (DTX2 Produits)

Synonymes: anticorps RNF58, anticorps 2610524D08Rik, anticorps AA408415, anticorps AU022494, anticorps Deltex2, anticorps dtx2, anticorps deltex E3 ubiquitin ligase 2, anticorps probable E3 ubiquitin-protein ligase DTX2, anticorps deltex 2, E3 ubiquitin ligase, anticorps deltex 2, E3 ubiquitin ligase S homeolog, anticorps DTX2, anticorps Dtx2, anticorps LOC735784, anticorps LOC747633, anticorps dtx2, anticorps dtx2.S

Sujet: DTX2 is a regulator of Notch signaling, a signaling pathway involved in cell-cell communications that regulates a broad spectrum of cell-fate determinations. DTX2 probably acts both as a positive and negative regulator of Notch, depending on the developmental and cell context and mediates the antineural activity of Notch, possibly by inhibiting the transcriptional activation mediated by MATCH1. It also functions as an ubiquitin ligase protein in vitro, suggesting that it may regulate the Notch pathway via some ubiquitin ligase activity.

Poids moléculaire: 62 kDa (MW of target protein)

Pathways: Signalisation Notch